PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA08G03920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 143aa    MW: 15722.1 Da    PI: 4.1267
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA08G03920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26041.53.9e-13216754100
           DUF260  54 redamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                        + m+++vy A+ar++dP+ Ga+g ilklqqql++lkae a+++++
  ONIVA08G03920.1  21 TVISMAAVVYLADARVEDPILGAYGRILKLQQQLDRLKAERARQHHP 67 
                      5789**************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031958.5E-82164IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MERILGFSEA EKQGIRPNGS TVISMAAVVY LADARVEDPI LGAYGRILKL QQQLDRLKAE  60
RARQHHPATS SPAPADDVAL QPEPFHQPPA QPSTPPALAI PDEEEEEDND DDEDEDEEEG  120
QEEGEGHAPA DDDVPCAKRR KHN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649522.14e-98PREDICTED: LOB domain-containing protein 1
RefseqXP_015649523.14e-98PREDICTED: LOB domain-containing protein 1
TrEMBLA0A0E0I7K82e-99A0A0E0I7K8_ORYNI; Uncharacterized protein
TrEMBLA2YRJ42e-99A2YRJ4_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA028043-PA7e-99(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16910911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.15e-06LOB domain-containing protein 4